PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015862
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 369aa    MW: 41472.8 Da    PI: 7.6928
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015862genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.71.1e-40140217178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC++ l +akeyhrrhkvCe hskap+v+v g+eqrfCqqCsrfh ++efD++krsCrrrLa+hnerrrk+++
  DCAR_015862 140 RCQVEGCHVALLNAKEYHRRHKVCELHSKAPKVVVLGMEQRFCQQCSRFHLVTEFDDTKRSCRRRLAGHNERRRKSSQ 217
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-34136202IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.154138215IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-38139219IPR004333Transcription factor, SBP-box
PfamPF031101.6E-31141214IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
METACNLFHN NSNNNNNNNN NNSSRGPFYN FTHFAWDNNI NNWELATPSS HSHSAASHYD  60
LFHHPPEMLY GGALYGGGVS GPHNHPDPHL MCLKLGKRNY FEDPNGRNVS TGLTISKRGR  120
GYCDGGEAAV TVAIPATVPR CQVEGCHVAL LNAKEYHRRH KVCELHSKAP KVVVLGMEQR  180
FCQQCSRFHL VTEFDDTKRS CRRRLAGHNE RRRKSSQEHS TTVIRNNNPS QGRALSLLSS  240
RNDSSISSPD LSSRCSAALR ELIAENRAAL LAKQFVFDKD LPFHHAEDVN VQQNNHSSHH  300
HYHHHPLVST NESHMFSEPQ GWDRFDEPGT NNVTLDLMQA PTSAFELLSM RGKSKEDEEC  360
SQLWSSFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291412141184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007052205.11e-103Squamosa promoter-binding-like protein 10, putative
SwissprotQ7XT423e-59SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A061DVD01e-103A0A061DVD0_THECC; Squamosa promoter-binding-like protein 10, putative
TrEMBLA0A068UPD11e-103A0A068UPD1_COFCA; Uncharacterized protein
STRINGVIT_15s0021g02290.t015e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA134081417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.48e-36squamosa promoter binding protein-like 10